TMEM51 (NM_001136218) Human Recombinant Protein
CAT#: TP326856
Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 3, 20 µg
View other "TMEM51" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226856 protein sequence
Red=Cloning site Green=Tags(s) MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129690 |
| Locus ID | 55092 |
| UniProt ID | Q9NW97 |
| Refseq Size | 2000 |
| Cytogenetics | 1p36.21 |
| Refseq ORF | 759 |
| Synonyms | C1orf72 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413385 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427856 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427857 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427858 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413385 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 |
CNY 3080.00 |
|
| LY427856 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 1 |
CNY 3080.00 |
|
| LY427857 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 2 |
CNY 3080.00 |
|
| LY427858 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 3 |
CNY 3080.00 |
|
| PH300965 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492) |
CNY 19520.00 |
|
| PH326828 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129689) |
CNY 14250.00 |
|
| PH326856 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690) |
CNY 14250.00 |
|
| TP300965 | Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP326828 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 2, 20 µg |
CNY 2900.00 |
