TMEM51 (NM_018022) Human Mass Spec Standard
CAT#: PH300965
TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492)
View other "TMEM51" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200965 |
| Predicted MW | 27.8 kDa |
| Protein Sequence |
>RC200965 protein sequence
Red=Cloning site Green=Tags(s) MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060492 |
| RefSeq Size | 1927 |
| RefSeq ORF | 759 |
| Synonyms | C1orf72 |
| Locus ID | 55092 |
| Cytogenetics | 1p36.21 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413385 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427856 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427857 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427858 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413385 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 |
CNY 3080.00 |
|
| LY427856 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 1 |
CNY 3080.00 |
|
| LY427857 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 2 |
CNY 3080.00 |
|
| LY427858 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 3 |
CNY 3080.00 |
|
| PH326828 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129689) |
CNY 14250.00 |
|
| PH326856 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690) |
CNY 14250.00 |
|
| TP300965 | Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP326828 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326856 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 3, 20 µg |
CNY 2900.00 |
