TMEM51 (NM_001136218) Human Mass Spec Standard
CAT#: PH326856
TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690)
View other "TMEM51" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226856 |
Predicted MW | 27.8 kDa |
Protein Sequence |
>RC226856 protein sequence
Red=Cloning site Green=Tags(s) MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129690 |
RefSeq Size | 2000 |
RefSeq ORF | 759 |
Synonyms | C1orf72 |
Locus ID | 55092 |
Cytogenetics | 1p36.21 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413385 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427856 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427857 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427858 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413385 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 |
CNY 3080.00 |
|
LY427856 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 1 |
CNY 3080.00 |
|
LY427857 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 2 |
CNY 3080.00 |
|
LY427858 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 3 |
CNY 3080.00 |
|
PH300965 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492) |
CNY 19520.00 |
|
PH326828 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129689) |
CNY 14250.00 |
|
TP300965 | Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP326828 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326856 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 3, 20 µg |
CNY 2900.00 |