ICA1 (NM_001136020) Human Recombinant Protein
CAT#: TP326813
Purified recombinant protein of Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), 20 µg
View other "ICA1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226813 representing NM_001136020
Red=Cloning site Green=Tags(s) MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129492 |
Locus ID | 3382 |
UniProt ID | Q05084 |
Cytogenetics | 7p21.3 |
Refseq ORF | 1446 |
Synonyms | ICA69; ICAp69 |
Summary | This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013] |
Protein Pathways | Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402921 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417620 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427769 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402921 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1 |
CNY 3080.00 |
|
LY417620 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2 |
CNY 3080.00 |
|
LY427769 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1) |
CNY 3080.00 |
|
PH302149 | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959) |
CNY 19520.00 |
|
PH326813 | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492) |
CNY 14250.00 |
|
TP302149 | Recombinant protein of human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 20 µg |
CNY 2900.00 |