ICA1 (NM_001136020) Human Mass Spec Standard
CAT＃: PH326813
ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492)
View other "ICA1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226813 |
| Predicted MW | 54.5 kDa |
| Protein Sequence |
>RC226813 representing NM_001136020
Red=Cloning site Green=Tags(s) MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129492 |
| RefSeq ORF | 1446 |
| Synonyms | ICA69; ICAp69 |
| Locus ID | 3382 |
| Cytogenetics | 7p21.3 |
| Summary | This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013] |
| Protein Pathways | Type I diabetes mellitus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402921 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417620 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427769 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402921 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1 |
CNY 3080.00 |
|
| LY417620 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2 |
CNY 3080.00 |
|
| LY427769 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1) |
CNY 3080.00 |
|
| PH302149 | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959) |
CNY 19520.00 |
|
| TP302149 | Recombinant protein of human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326813 | Purified recombinant protein of Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), 20 µg |
CNY 2900.00 |
