ICA1 (NM_004968) Human Mass Spec Standard
CAT#: PH302149
ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959)
View other "ICA1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202149 |
Predicted MW | 54.5 kDa |
Protein Sequence |
>RC202149 representing NM_004968
Red=Cloning site Green=Tags(s) MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004959 |
RefSeq Size | 2396 |
RefSeq ORF | 1446 |
Synonyms | ICA69; ICAp69 |
Locus ID | 3382 |
Cytogenetics | 7p21.3 |
Summary | This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013] |
Protein Pathways | Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402921 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417620 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427769 | ICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402921 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1 |
CNY 3080.00 |
|
LY417620 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2 |
CNY 3080.00 |
|
LY427769 | Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1) |
CNY 3080.00 |
|
PH326813 | ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492) |
CNY 14250.00 |
|
TP302149 | Recombinant protein of human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326813 | Purified recombinant protein of Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), 20 µg |
CNY 2900.00 |