DSN1 (NM_001145318) Human Recombinant Protein
CAT#: TP326656
Purified recombinant protein of Homo sapiens DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5, 20 µg
View other "DSN1" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226656 representing NM_001145318
Red=Cloning site Green=Tags(s) MSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQS ASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDT KGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWD QLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQ GSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138790 |
Locus ID | 79980 |
UniProt ID | Q9H410 |
Cytogenetics | 20q11.23 |
Refseq ORF | 1020 |
Synonyms | C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13 |
Summary | This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411014 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428819 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428821 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411014 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3 |
CNY 3080.00 |
|
LY428819 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1 |
CNY 3080.00 |
|
LY428821 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5 |
CNY 3080.00 |
|
PH316609 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_079194) |
CNY 19520.00 |
|
PH326614 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138788) |
CNY 19520.00 |
|
PH326656 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790) |
CNY 14250.00 |
|
TP316609 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP326614 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1, 20 µg |
CNY 2900.00 |