DSN1 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DSN1 antibody is: synthetic peptide directed towards the N-terminal region of Human DSN1. Synthetic peptide located within the following region: SKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | DSN1 homolog, MIS12 kinetochore complex component |
Database Link | |
Background | This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. |
Synonyms | C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Rat: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |