DSN1 (NM_001145318) Human Mass Spec Standard
CAT#: PH326656
DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790)
View other "DSN1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226656 |
Predicted MW | 38.1 kDa |
Protein Sequence |
>RC226656 representing NM_001145318
Red=Cloning site Green=Tags(s) MSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQS ASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDT KGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWD QLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQ GSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001138790 |
RefSeq ORF | 1020 |
Synonyms | C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13 |
Locus ID | 79980 |
Cytogenetics | 20q11.23 |
Summary | This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411014 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428819 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428821 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411014 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3 |
CNY 3080.00 |
|
LY428819 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1 |
CNY 3080.00 |
|
LY428821 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5 |
CNY 3080.00 |
|
PH316609 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_079194) |
CNY 19520.00 |
|
PH326614 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138788) |
CNY 19520.00 |
|
TP316609 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP326614 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326656 | Purified recombinant protein of Homo sapiens DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5, 20 µg |
CNY 2900.00 |