MLX (NM_198205) Human Recombinant Protein
CAT#: TP323064
Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223064 representing NM_198205
Red=Cloning site Green=Tags(s) MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQT IVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQD NPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK NQLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_937848 |
Locus ID | 6945 |
UniProt ID | Q9UH92 |
Refseq Size | 2316 |
Cytogenetics | 17q21.2 |
Refseq ORF | 642 |
Synonyms | bHLHd13; MAD7; MXD7; TCFL4; TF4 |
Summary | The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404977 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404978 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406915 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404977 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 2 |
CNY 3080.00 |
|
LY404978 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 1 |
CNY 3080.00 |
|
LY406915 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 |
CNY 3080.00 |
|
PH301911 | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847) |
CNY 19520.00 |
|
PH323064 | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848) |
CNY 14250.00 |
|
TP301911 | Recombinant protein of human MAX-like protein X (MLX), transcript variant 2, 20 µg |
CNY 2900.00 |