MLX (NM_198205) Human Mass Spec Standard
CAT#: PH323064
MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223064 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC223064 representing NM_198205
Red=Cloning site Green=Tags(s) MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQT IVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQD NPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK NQLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_937848 |
| RefSeq Size | 2316 |
| RefSeq ORF | 642 |
| Synonyms | bHLHd13; MAD7; MXD7; TCFL4; TF4 |
| Locus ID | 6945 |
| Cytogenetics | 17q21.2 |
| Summary | The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404977 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404978 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406915 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404977 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 2 |
CNY 3080.00 |
|
| LY404978 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 1 |
CNY 3080.00 |
|
| LY406915 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 |
CNY 3080.00 |
|
| PH301911 | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847) |
CNY 19520.00 |
|
| TP301911 | Recombinant protein of human MAX-like protein X (MLX), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323064 | Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1, 20 µg |
CNY 2900.00 |
