MLX (NM_198204) Human Mass Spec Standard
CAT#: PH301911
MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201911 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC201911 protein sequence
Red=Cloning site Green=Tags(s) MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKE SYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQ EEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQE LSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_937847 |
RefSeq Size | 2406 |
RefSeq ORF | 732 |
Synonyms | bHLHd13; MAD7; MXD7; TCFL4; TF4 |
Locus ID | 6945 |
Cytogenetics | 17q21.2 |
Summary | The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404977 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404978 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406915 | MLX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404977 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 2 |
CNY 3080.00 |
|
LY404978 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 1 |
CNY 3080.00 |
|
LY406915 | Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 |
CNY 3080.00 |
|
PH323064 | MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848) |
CNY 14250.00 |
|
TP301911 | Recombinant protein of human MAX-like protein X (MLX), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP323064 | Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1, 20 µg |
CNY 2900.00 |