TMPRSS4 (NM_019894) Human Recombinant Protein
CAT#: TP303972
Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg
View other "TMPRSS4" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203972 protein sequence
Red=Cloning site Green=Tags(s) MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC RQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEE ASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQV IDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT KVSAYLNWIYNVWKAEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 29529050) |
| Reference Data | |
| RefSeq | NP_063947 |
| Locus ID | 56649 |
| UniProt ID | Q9NRS4 |
| Refseq Size | 3549 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 1311 |
| Synonyms | CAP2; CAPH2; MT-SP2; TMPRSS3 |
| Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Transmembrane protease, serine 4 (TMPRSS4) is upregulated in IPF lungs and increases the fibrotic response in bleomycin-induced lung injury
,Valero-Jiménez, A;Zúñiga, J;Cisneros, J;Becerril, C;Salgado, A;Checa, M;Buendía-Roldán, I;Mendoza-Milla, C;Gaxiola, M;Pardo, A;Selman, M;,
PLoS ONE
,PubMed ID 29529050
[TMPRSS4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
CNY 3080.00 |
|
| LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
CNY 3080.00 |
|
| LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
CNY 3080.00 |
|
| PH302384 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) |
CNY 19520.00 |
|
| PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
CNY 19520.00 |
|
| PH324725 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) |
CNY 14250.00 |
|
| TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP324725 | Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg |
CNY 2900.00 |
其它TMPRSS4产品
