TMPRSS4 (NM_001083947) Human Mass Spec Standard
CAT#: PH324725
TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416)
View other "TMPRSS4" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224725 |
| Predicted MW | 47.5 kDa |
| Protein Sequence |
>RC224725 representing NM_001083947
Red=Cloning site Green=Tags(s) MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC RQMGYSRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDS WPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMY PKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTR CNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAY LNWIYNVWKAEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001077416 |
| RefSeq Size | 3534 |
| RefSeq ORF | 1296 |
| Synonyms | CAP2; CAPH2; MT-SP2; TMPRSS3 |
| Locus ID | 56649 |
| Cytogenetics | 11q23.3 |
| Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
CNY 3080.00 |
|
| LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
CNY 3080.00 |
|
| LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
CNY 3080.00 |
|
| PH302384 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) |
CNY 19520.00 |
|
| PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
CNY 19520.00 |
|
| TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP303972 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324725 | Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg |
CNY 2900.00 |
其它TMPRSS4产品
