TMPRSS4 (NM_183247) Human Mass Spec Standard
CAT#: PH302384
TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070)
View other "TMPRSS4" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202384 |
Predicted MW | 37.2 kDa |
Protein Sequence |
>RC202384 protein sequence
Red=Cloning site Green=Tags(s) MDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHFIP RKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQ MGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEAS VDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFN PMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899070 |
RefSeq Size | 1983 |
RefSeq ORF | 1005 |
Synonyms | membrane-type serine protease 2; MT-SP2; MT-SP2, TMPRSS3; TMPRSS3; transmembrane protease, serine 4; transmembrane serine protease 3; type II membrane serine protease |
Locus ID | 56649 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
CNY 3080.00 |
|
LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
CNY 3080.00 |
|
LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
CNY 3080.00 |
|
PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
CNY 19520.00 |
|
PH324725 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) |
CNY 14250.00 |
|
TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP303972 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP324725 | Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg |
CNY 2900.00 |
其它TMPRSS4产品