NUDT22 (NM_032344) Human Recombinant Protein
CAT#: TP302982
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1, 20 µg
View other "NUDT22" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202982 protein sequence
Red=Cloning site Green=Tags(s) MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII LYNRVQGSPTGAALGSPALLPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115720 |
Locus ID | 84304 |
UniProt ID | Q9BRQ3 |
Refseq Size | 1141 |
Cytogenetics | 11q13.1 |
Refseq ORF | 909 |
Summary | Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410181 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426974 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426975 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410181 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1 |
CNY 3080.00 |
|
LY426974 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 2 |
CNY 3080.00 |
|
LY426975 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 3 |
CNY 3080.00 |
|
PH302982 | NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720) |
CNY 19520.00 |