NUDT22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NUDT22 antibody: synthetic peptide directed towards the C terminal of human NUDT22. Synthetic peptide located within the following region: FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	nudix hydrolase 22
Database Link	NP_115720 Entrez Gene 84304 Human UniProt ID Q9BRQ3
Background	The function remains unknown.
Synonyms	MGC13045
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.