NUDT22 (NM_032344) Human Mass Spec Standard
CAT＃: PH302982
NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720)
View other "NUDT22" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202982 |
| Predicted MW | 32.6 kDa |
| Protein Sequence |
>RC202982 protein sequence
Red=Cloning site Green=Tags(s) MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII LYNRVQGSPTGAALGSPALLPPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115720 |
| RefSeq Size | 1141 |
| RefSeq ORF | 909 |
| Locus ID | 84304 |
| Cytogenetics | 11q13.1 |
| Summary | Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410181 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426974 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426975 | NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410181 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1 |
CNY 3080.00 |
|
| LY426974 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 2 |
CNY 3080.00 |
|
| LY426975 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 3 |
CNY 3080.00 |
|
| TP302982 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
