LYRM4 (NM_020408) Human Recombinant Protein
CAT#: TP302346
Recombinant protein of human LYR motif containing 4 (LYRM4), 20 µg
View other "LYRM4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202346 protein sequence
Red=Cloning site Green=Tags(s) MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV HIGQLYSTDKLIIENRDMPRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065141 |
| Locus ID | 57128 |
| UniProt ID | Q9HD34 |
| Refseq Size | 1514 |
| Cytogenetics | 6p25.1 |
| Refseq ORF | 273 |
| Synonyms | C6orf149; CGI-203; COXPD19; ISD11 |
| Summary | The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412489 | LYRM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412489 | Transient overexpression lysate of LYR motif containing 4 (LYRM4), transcript variant 1 |
CNY 3080.00 |
|
| PH302346 | LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141) |
CNY 19520.00 |
|
| TP762521 | Purified recombinant protein of Human LYR motif containing 4 (LYRM4), transcript variant 1, full length, 50ug |
CNY 2480.00 |
