LYRM4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lyrm4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	LYR motif containing 4
Database Link	NP_065141 Entrez Gene 380840 Mouse UniProt ID Q9HD34
Background	Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.
Synonyms	C6orf149; CGI-203; COXPD19; ISD11
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.