LYRM4 (NM_020408) Human Mass Spec Standard
CAT#: PH302346
LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141)
View other "LYRM4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202346 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC202346 protein sequence
Red=Cloning site Green=Tags(s) MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV HIGQLYSTDKLIIENRDMPRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065141 |
RefSeq Size | 1514 |
RefSeq ORF | 273 |
Synonyms | C6orf149; CGI-203; COXPD19; ISD11 |
Locus ID | 57128 |
Cytogenetics | 6p25.1 |
Summary | The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412489 | LYRM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412489 | Transient overexpression lysate of LYR motif containing 4 (LYRM4), transcript variant 1 |
CNY 3080.00 |
|
TP302346 | Recombinant protein of human LYR motif containing 4 (LYRM4), 20 µg |
CNY 2900.00 |
|
TP762521 | Purified recombinant protein of Human LYR motif containing 4 (LYRM4), transcript variant 1, full length, 50ug |
CNY 2480.00 |