POLR1D (NM_015972) Human Recombinant Protein
CAT#: TP301466
Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 20 µg
View other "POLR1D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201466 protein sequence
Red=Cloning site Green=Tags(s) MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057056 |
| Locus ID | 51082 |
| UniProt ID | P0DPB6 |
| Refseq Size | 817 |
| Cytogenetics | 13q12.2 |
| Refseq ORF | 399 |
| Synonyms | AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 |
| Summary | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] |
| Protein Families | Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407348 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414277 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407348 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2 |
CNY 3080.00 |
|
| LY414277 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 |
CNY 3080.00 |
|
| PH301466 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056) |
CNY 19520.00 |
|
| PH302300 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) |
CNY 19520.00 |
|
| TP302300 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 20 µg |
CNY 2900.00 |
