POLR1D (NM_152705) Human Mass Spec Standard
CAT#: PH302300
POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918)
View other "POLR1D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202300 |
| Predicted MW | 14.3 kDa |
| Protein Sequence |
>RC202300 protein sequence
Red=Cloning site Green=Tags(s) MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDK EPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689918 |
| RefSeq Size | 2043 |
| RefSeq ORF | 366 |
| Synonyms | AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 |
| Locus ID | 51082 |
| Cytogenetics | 13q12.2 |
| Summary | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] |
| Protein Families | Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407348 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414277 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407348 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2 |
CNY 3080.00 |
|
| LY414277 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 |
CNY 3080.00 |
|
| PH301466 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056) |
CNY 19520.00 |
|
| TP301466 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP302300 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 20 µg |
CNY 2900.00 |
