POLR1D Rabbit Polyclonal Antibody
CAT#: TA346781
Rabbit Polyclonal Anti-POLR1D Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 15 kDa |
Gene Name | polymerase (RNA) I subunit D |
Database Link | |
Background | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] |
Synonyms | AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |