HIGD2A (NM_138820) Human Recombinant Protein
CAT#: TP301223
Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), 20 µg
View other "HIGD2A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201223 protein sequence
Red=Cloning site Green=Tags(s) MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_620175 |
| Locus ID | 192286 |
| UniProt ID | Q9BW72 |
| Refseq Size | 628 |
| Cytogenetics | 5q35.2 |
| Refseq ORF | 318 |
| Synonyms | RCF1b |
| Summary | The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408465 | HIGD2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408465 | Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) |
CNY 3080.00 |
|
| PH301223 | HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175) |
CNY 19520.00 |
