HIGD2A (NM_138820) Human Mass Spec Standard
CAT#: PH301223
HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175)
View other "HIGD2A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201223 |
| Predicted MW | 11.5 kDa |
| Protein Sequence |
>RC201223 protein sequence
Red=Cloning site Green=Tags(s) MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620175 |
| RefSeq Size | 628 |
| RefSeq ORF | 318 |
| Synonyms | RCF1b |
| Locus ID | 192286 |
| Cytogenetics | 5q35.2 |
| Summary | The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408465 | HIGD2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408465 | Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) |
CNY 3080.00 |
|
| TP301223 | Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), 20 µg |
CNY 2900.00 |
