VKORC1 (NM_206824) Human Mass Spec Standard
CAT#: PH314831
VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560)
View other "VKORC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214831 |
Predicted MW | 9.7 kDa |
Protein Sequence |
>RC214831 representing NM_206824
Red=Cloning site Green=Tags(s) MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDA AELPGVSRWFCLPGLDPVLRAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996560 |
RefSeq Size | 907 |
RefSeq ORF | 276 |
Synonyms | EDTP308; MST134; MST576; VKCFD2; VKOR |
Locus ID | 79001 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402968 | VKORC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402968 | Transient overexpression lysate of vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1 |
CNY 3080.00 |
|
TP314831 | Recombinant protein of human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, 20 µg |
CNY 2900.00 |