VKORC1 (NM_206824) Human Recombinant Protein
CAT#: TP314831M
Recombinant protein of human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
货期*
4周
规格
推荐一起购买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214831 representing NM_206824
Red=Cloning site Green=Tags(s) MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDA AELPGVSRWFCLPGLDPVLRAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996560 |
Locus ID | 79001 |
UniProt ID | Q9BQB6 |
Refseq Size | 907 |
Cytogenetics | 16p11.2 |
Refseq ORF | 276 |
Synonyms | EDTP308; MST134; MST576; VKCFD2; VKOR |
Summary | This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...