Recombinant IL-36RA (Interleukin-36 receptor antagonist),Mouse

CAT#: TP728358L

Recombinant IL-36RA (Interleukin-36 receptor antagonist),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 17.81 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9QYY1
Synonyms FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta
Summary Interleukin 36 receptor antagonist (IL-36RA) is a 17.21 kDa cytokine with 155 amino acid residues and a member of the IL-36 family. It is mainly secreted from the stomach, lungs, and kidneys. IL-36RA binds to the interleukin-36 receptor and plays a critical role in the anti-inflammatory effect by mediating MAPK and NF-κB signaling pathways. IL-36RA inhibits proinflammatory effect via suppressing production of IL-6, IL-17, and interferon-gamma and promoting production of IL-4.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...