Recombinant IL-36RA (Interleukin-36 receptor antagonist), Mouse
CAT#: TP728358S
Recombinant IL-36RA (Interleukin-36 receptor antagonist), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 17.81 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <2 μg/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9QYY1 |
| Synonyms | FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta |
| Summary | Interleukin 36 receptor antagonist (IL-36RA) is a 17.21 kDa cytokine with 155 amino acid residues and a member of the IL-36 family. It is mainly secreted from the stomach, lungs, and kidneys. IL-36RA binds to the interleukin-36 receptor and plays a critical role in the anti-inflammatory effect by mediating MAPK and NF-κB signaling pathways. IL-36RA inhibits proinflammatory effect via suppressing production of IL-6, IL-17, and interferon-gamma and promoting production of IL-4. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
