Recombinant 4-1BBL (4-1BB ligand), Mouse

CAT#: TP728295L

Recombinant 4-1BBL (4-1BB ligand), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 23.9 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <0.05 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P41274
Synonyms 4-1BB, 4-1BB-, 4-1BB-L, 4-1BBL, AI848817, Cd137, Cd137l, Ly6, Ly63l,tumor necrosis factor (ligand) superfamily, member 9 , Tnfsf9
Summary 4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...