Recombinant 4-1BBL (4-1BB ligand), Mouse
CAT#: TP728295
Recombinant 4-1BBL (4-1BB ligand), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 23.9 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <0.05 μg/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P41274 |
| Synonyms | 4-1BB, 4-1BB-, 4-1BB-L, 4-1BBL, AI848817, Cd137, Cd137l, Ly6, Ly63l,tumor necrosis factor (ligand) superfamily, member 9 , Tnfsf9 |
| Summary | 4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
