Recombinant IGF-II (Insulin-like growth factor-II), Human
CAT#: TP728232M
Recombinant IGF-II (Insulin-like growth factor-II), Human
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 8.28 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <3 ng/mL. The specific activity of recombinant human IGF-II is > 3x 10⁵ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P01344 |
| Synonyms | Somatamedin A |
| Summary | Insulin like Growth Factors 2 (IGF-II) is a 7.48 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from placenta, extravillous trophoblasts, leydig cells, syncytiotrophoblasts, cytotrophoblasts, peritubular cells. IGF-II regulating fetoplacental development and tissue differentiation. In adults, IGF-II signaling involves glucose metabolism in adipose tissue, skeletal muscle and liver. It also has important implications for metabolic disorders and cancer. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
