Recombinant IGF-II (Insulin-like growth factor-II), Human

CAT#: TP728232L

Recombinant IGF-II (Insulin-like growth factor-II), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.28 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <3 ng/mL. The specific activity of recombinant human IGF-II is > 3x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01344
Synonyms Somatamedin A
Summary Insulin like Growth Factors 2 (IGF-II) is a 7.48 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from placenta, extravillous trophoblasts, leydig cells, syncytiotrophoblasts, cytotrophoblasts, peritubular cells. IGF-II regulating fetoplacental development and tissue differentiation. In adults, IGF-II signaling involves glucose metabolism in adipose tissue, skeletal muscle and liver. It also has important implications for metabolic disorders and cancer.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...