Nudt16l1 (BC025569) Mouse Recombinant Protein
CAT#: TP501080
Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (cDNA clone MGC:35707 IMAGE:5322456),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201080 protein sequence
Red=Cloning site Green=Tags(s) MSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR FWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVG LLPGARPHSHS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 66911 |
UniProt ID | Q8VHN8 |
Refseq Size | 1354 |
Cytogenetics | 16 2.48 cM |
Refseq ORF | 453 |
Synonyms | 1110001K21Rik; 5330437I08Rik; Sdos |
Summary | Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin. In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus. Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs). Binds U8 snoRNA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Nudt16l1产品