MD2 (LY96) (NM_001195797) Human Recombinant Protein
CAT#: TP330968
Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC230968 representing NM_001195797
Red=Cloning site Green=Tags(s) MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCGRDLKQLYFNLYITVNTMNLPKRKEVICRGSDD DYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001182726 |
Locus ID | 23643 |
UniProt ID | Q9Y6Y9 |
Refseq Size | 552 |
Cytogenetics | 8q21.11 |
Refseq ORF | 390 |
Synonyms | ESOP-1; ly-96; MD-2; MD2 |
Summary | This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010] |
Protein Families | Secreted Protein |
Protein Pathways | Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414593 | LY96 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414593 | Transient overexpression lysate of lymphocyte antigen 96 (LY96) |
CNY 3080.00 |
|
PH304686 | LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179) |
CNY 19520.00 |
|
TP304686 | Recombinant protein of human lymphocyte antigen 96 (LY96), 20 µg |
CNY 2900.00 |