ZFYVE27 (NM_001174121) Human Recombinant Protein
CAT#: TP329865
Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg
View other "ZFYVE27" proteins (19)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229865 representing NM_001174121
Red=Cloning site Green=Tags(s) MISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCE AAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQ EEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEEDDEGAPCPAE DELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSF KVPKSSMGATAPEAQRETVFVCASCNQTLSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.1 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001167592 |
| Locus ID | 118813 |
| UniProt ID | Q5T4F4 |
| Cytogenetics | 10q24.2 |
| Refseq ORF | 933 |
| Synonyms | PROTRUDIN; SPG33 |
| Summary | This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403394 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424194 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424195 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432830 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432865 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432877 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432956 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403394 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 |
CNY 3080.00 |
|
| LY424194 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 |
CNY 4840.00 |
|
| LY424195 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 |
CNY 3080.00 |
|
| LY432830 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 |
CNY 3080.00 |
|
| LY432865 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 |
CNY 3080.00 |
|
| LY432877 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 |
CNY 3080.00 |
|
| LY432956 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 |
CNY 3080.00 |
|
| PH306193 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) |
CNY 19520.00 |
|
| PH319897 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) |
CNY 14250.00 |
|
| TP306193 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319897 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP329877 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg |
CNY 2900.00 |
其它ZFYVE27产品
