ZFYVE27 (NM_001002261) Human Mass Spec Standard
CAT＃: PH319897
ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261)
View other "ZFYVE27" proteins (19)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219897 |
| Predicted MW | 46.2 kDa |
| Protein Sequence |
>RC219897 representing NM_001002261
Red=Cloning site Green=Tags(s) MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSV EEAEEAEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTN NFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002261 |
| RefSeq Size | 3045 |
| RefSeq ORF | 1248 |
| Synonyms | PROTRUDIN; SPG33 |
| Locus ID | 118813 |
| Cytogenetics | 10q24.2 |
| Summary | This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403394 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424194 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424195 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432830 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432865 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432877 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432956 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403394 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 |
CNY 3080.00 |
|
| LY424194 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 |
CNY 4840.00 |
|
| LY424195 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 |
CNY 3080.00 |
|
| LY432830 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 |
CNY 3080.00 |
|
| LY432865 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 |
CNY 3080.00 |
|
| LY432877 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 |
CNY 3080.00 |
|
| LY432956 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 |
CNY 3080.00 |
|
| PH306193 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) |
CNY 19520.00 |
|
| TP306193 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319897 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP329865 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP329877 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg |
CNY 2900.00 |
其它ZFYVE27产品
