MBNL3 (NM_001170701) Human Recombinant Protein
CAT#: TP329854
Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg
View other "MBNL3" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229854 representing NM_001170701
Red=Cloning site Green=Tags(s) MERASKNLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT PSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTR GENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQ PGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTT VSAATTPATSVPFAAPTTGNQLKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.4 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001164172 |
| Locus ID | 55796 |
| UniProt ID | Q9NUK0 |
| Cytogenetics | Xq26.2 |
| Refseq ORF | 912 |
| Synonyms | CHCR; MBLX; MBLX39; MBXL |
| Summary | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408817 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413087 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432842 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432854 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408817 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 |
CNY 3080.00 |
|
| LY413087 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 |
CNY 3080.00 |
|
| LY432842 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 |
CNY 3080.00 |
|
| LY432854 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 |
CNY 3080.00 |
|
| PH316043 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) |
CNY 14250.00 |
|
| PH316093 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) |
CNY 19520.00 |
|
| TP316043 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg |
CNY 2900.00 |
|
| TP316093 | Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg |
CNY 2900.00 |
|
| TP329842 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg |
CNY 2900.00 |
