MBNL3 (NM_018388) Human Mass Spec Standard
CAT＃: PH316043
MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858)
View other "MBNL3" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216043 |
| Predicted MW | 38.4 kDa |
| Protein Sequence |
>RC216043 representing NM_018388
Red=Cloning site Green=Tags(s) MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN QLKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060858 |
| RefSeq Size | 2701 |
| RefSeq ORF | 1062 |
| Synonyms | CHCR; MBLX; MBLX39; MBXL |
| Locus ID | 55796 |
| Cytogenetics | Xq26.2 |
| Summary | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408817 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413087 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432842 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432854 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408817 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 |
CNY 3080.00 |
|
| LY413087 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 |
CNY 3080.00 |
|
| LY432842 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 |
CNY 3080.00 |
|
| LY432854 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 |
CNY 3080.00 |
|
| PH316093 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) |
CNY 19520.00 |
|
| TP316043 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg |
CNY 2900.00 |
|
| TP316093 | Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg |
CNY 2900.00 |
|
| TP329842 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP329854 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg |
CNY 2900.00 |
