LRTM2 (NM_001163925) Human Recombinant Protein
CAT#: TP328853
Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2, 20 µg
View other "LRTM2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228853 representing NM_001163925
Red=Cloning site Green=Tags(s) MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ PLMGDPEGEHEDQKQISSVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001157397 |
| Locus ID | 654429 |
| UniProt ID | Q8N967 |
| Cytogenetics | 12p13.33 |
| Refseq ORF | 1110 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422012 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431881 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431882 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422012 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 1 |
CNY 3080.00 |
|
| LY431881 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2 |
CNY 3080.00 |
|
| LY431882 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 3 |
CNY 3080.00 |
|
| PH323599 | LRTM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034118) |
CNY 19520.00 |
|
| TP323599 | Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), 20 µg |
CNY 2900.00 |
