LRTM2 (NM_001039029) Human Mass Spec Standard
CAT＃: PH323599
LRTM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034118)
View other "LRTM2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | LRTM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034118) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223599 |
| Predicted MW | 41 kDa |
| Protein Sequence |
>RC223599 representing NM_001039029
Red=Cloning site Green=Tags(s) MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ PLMGDPEGEHEDQKQISSVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034118 |
| RefSeq Size | 3688 |
| RefSeq ORF | 1110 |
| Locus ID | 654429 |
| Cytogenetics | 12p13.33 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422012 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431881 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431882 | LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422012 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 1 |
CNY 3080.00 |
|
| LY431881 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2 |
CNY 3080.00 |
|
| LY431882 | Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 3 |
CNY 3080.00 |
|
| TP323599 | Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), 20 µg |
CNY 2900.00 |
|
| TP328853 | Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2, 20 µg |
CNY 2900.00 |
