MINDY1 (NM_001163258) Human Recombinant Protein
CAT#: TP328423
Purified recombinant protein of Homo sapiens family with sequence similarity 63, member A (FAM63A), transcript variant 3, 20 µg
View other "MINDY1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228423 representing NM_001163258
Red=Cloning site Green=Tags(s) MLLGPPPFNESTKPSPSPCHSFASQAWLRQVPEVSKHLQCPSAKSLLTMEYHQPEDPAPGKAGTAEAVIP ENHEVLAGPDEHPQDTDARDADGEAREREPADQALLPSQCGDNLESPLPEASSAPPGPTLGTLPEVETIR ACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLLAIMNILFLQWKVKLPPQKEVIT SDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDVNVRFTGVSDFEYTPECSVFDLL GIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTNLVTEGLIAEQFLETTAAQLTYHGLCEL TAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESLHNVDGDSCFCDSDFHLSHSLGK GPGAEGGSGSPEKQLQVDQDYLIALSLQQQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSL QGRGATSGRPAGERRQRPKHESDCILL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001156730 |
| Locus ID | 55793 |
| UniProt ID | Q8N5J2 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 1551 |
| Synonyms | FAM63A; MINDY-1 |
| Summary | Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413073 | FAM63A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413073 | Transient overexpression lysate of family with sequence similarity 63, member A (FAM63A), transcript variant 1 |
CNY 3080.00 |
|
| PH316010 | FAM63A MS Standard C13 and N15-labeled recombinant protein (NP_060849) |
CNY 19520.00 |
|
| TP316010 | Recombinant protein of human family with sequence similarity 63, member A (FAM63A), transcript variant 1, 20 µg |
CNY 2900.00 |
