MINDY1 (NM_018379) Human Recombinant Protein
CAT#: TP316010
Recombinant protein of human family with sequence similarity 63, member A (FAM63A), transcript variant 1, 20 µg
View other "MINDY1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216010 protein sequence
Red=Cloning site Green=Tags(s) MEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEHPQDTDARDADGEAREREPADQALLPSQCGDNLESPL PEASSAPPGPTLGTLPEVETIRACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLL AIMNILFLQWKVKLPPQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDV NVRFTGVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTNLVTEG LIAEQFLETTAAQLTYHGLCELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESL HNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPEKQLQVDQDYLIALSLQQQQPRGPLGLTDLELAQQLQ QEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCILL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060849 |
Locus ID | 55793 |
UniProt ID | Q8N5J2 |
Refseq Size | 2851 |
Cytogenetics | 1q21.3 |
Refseq ORF | 1407 |
Synonyms | FAM63A; MINDY-1 |
Summary | Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413073 | FAM63A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413073 | Transient overexpression lysate of family with sequence similarity 63, member A (FAM63A), transcript variant 1 |
CNY 3080.00 |
|
PH316010 | FAM63A MS Standard C13 and N15-labeled recombinant protein (NP_060849) |
CNY 19520.00 |
|
TP328423 | Purified recombinant protein of Homo sapiens family with sequence similarity 63, member A (FAM63A), transcript variant 3, 20 µg |
CNY 2900.00 |