DACH2 (NM_001139515) Human Recombinant Protein
CAT#: TP327811
Recombinant protein of human dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3, 20 µg
View other "DACH2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227811 representing NM_001139515
Red=Cloning site Green=Tags(s) MTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTL QGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHL LTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIHSPLSRAGTSVIKERIPESPSP APSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQIPIMKSPLDKIQLTPGQALPAGFPGPFI FADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLELYREREIRENLERQLAVELQSRTTMQK RLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNY YCLEMAQQLYSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001132987 |
| Locus ID | 117154 |
| UniProt ID | Q96NX9 |
| Cytogenetics | Xq21.2 |
| Refseq ORF | 1296 |
| Summary | This gene is one of two genes which encode a protein similar to the Drosophila protein dachshund, a transcription factor involved in cell fate determination in the eye, limb and genital disc of the fly. The encoded protein contains two characteristic dachshund domains: an N-terminal domain responsible for DNA binding and a C-terminal domain responsible for protein-protein interactions. This gene is located on the X chromosome and is subject to inactivation by DNA methylation. The encoded protein may be involved in regulation of organogenesis and myogenesis, and may play a role in premature ovarian failure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409299 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427975 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427976 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409299 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 1 |
CNY 4840.00 |
|
| LY427975 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 2 |
CNY 3080.00 |
|
| LY427976 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3 |
CNY 3080.00 |
|
| PH327811 | DACH2 MS Standard C13 and N15-labeled recombinant protein (NP_001132987) |
CNY 19520.00 |
