DACH2 (NM_001139515) Human Mass Spec Standard
CAT＃: PH327811
DACH2 MS Standard C13 and N15-labeled recombinant protein (NP_001132987)
View other "DACH2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | DACH2 MS Standard C13 and N15-labeled recombinant protein (NP_001132987) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227811 |
| Predicted MW | 47 kDa |
| Protein Sequence |
>RC227811 representing NM_001139515
Red=Cloning site Green=Tags(s) MTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTL QGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHL LTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIHSPLSRAGTSVIKERIPESPSP APSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQIPIMKSPLDKIQLTPGQALPAGFPGPFI FADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLELYREREIRENLERQLAVELQSRTTMQK RLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNY YCLEMAQQLYSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001132987 |
| RefSeq ORF | 1296 |
| Locus ID | 117154 |
| Cytogenetics | Xq21.2 |
| Summary | This gene is one of two genes which encode a protein similar to the Drosophila protein dachshund, a transcription factor involved in cell fate determination in the eye, limb and genital disc of the fly. The encoded protein contains two characteristic dachshund domains: an N-terminal domain responsible for DNA binding and a C-terminal domain responsible for protein-protein interactions. This gene is located on the X chromosome and is subject to inactivation by DNA methylation. The encoded protein may be involved in regulation of organogenesis and myogenesis, and may play a role in premature ovarian failure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409299 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427975 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427976 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409299 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 1 |
CNY 4840.00 |
|
| LY427975 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 2 |
CNY 3080.00 |
|
| LY427976 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3 |
CNY 3080.00 |
|
| TP327811 | Recombinant protein of human dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3, 20 µg |
CNY 2900.00 |
