JMJD5 (KDM8) (NM_001145348) Human Recombinant Protein
CAT#: TP327709
Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 1, 20 µg
View other "JMJD5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227709 representing NM_001145348
Red=Cloning site Green=Tags(s) MSREKCSPGEGAEEGRGSEASGLKASAGHGTEPAGGGPMAGDTHCPAEPLAREGTLWEALRALLPHSKED LKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLK ALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLKVAAILQTHLPGKRPARGSLPEQPCTKKARADH GLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSR YTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFG PQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFL SCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138820 |
| Locus ID | 79831 |
| UniProt ID | Q8N371 |
| Cytogenetics | 16p12.1 |
| Refseq ORF | 1362 |
| Synonyms | JMJD5 |
| Summary | This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403027 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428835 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403027 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 |
CNY 3080.00 |
|
| LY428835 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 1 |
CNY 3080.00 |
|
| PH306417 | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049) |
CNY 19520.00 |
|
| PH327709 | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_001138820) |
CNY 19520.00 |
|
| TP306417 | Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 2, 20 µg |
CNY 2900.00 |
