JMJD5 (KDM8) (NM_024773) Human Mass Spec Standard
CAT＃: PH306417
JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049)
View other "JMJD5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206417 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC206417 protein sequence
Red=Cloning site Green=Tags(s) MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079049 |
| RefSeq Size | 2481 |
| RefSeq ORF | 1248 |
| Synonyms | JMJD5 |
| Locus ID | 79831 |
| Cytogenetics | 16p12.1 |
| Summary | This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403027 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428835 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403027 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 |
CNY 3080.00 |
|
| LY428835 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 1 |
CNY 3080.00 |
|
| PH327709 | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_001138820) |
CNY 19520.00 |
|
| TP306417 | Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327709 | Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 1, 20 µg |
CNY 2900.00 |
