Kallikrein 11 (KLK11) (NM_001136032) Human Recombinant Protein
CAT#: TP327537
Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr, 20 µg
View other "Kallikrein 11" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227537 protein sequence
Red=Cloning site Green=Tags(s) MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIV HLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGT SCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCN QSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129504 |
| Locus ID | 11012 |
| UniProt ID | Q9UBX7 |
| Refseq Size | 1195 |
| Cytogenetics | 19q13.41 |
| Refseq ORF | 750 |
| Synonyms | PRSS20; TLSP |
| Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408096 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416376 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427779 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430122 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432810 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408096 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3080.00 |
|
| LY416376 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 |
CNY 3080.00 |
|
| LY427779 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 |
CNY 3080.00 |
|
| LY430122 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3080.00 |
|
| LY432810 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 |
CNY 3080.00 |
|
| PH306022 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) |
CNY 14250.00 |
|
| PH312547 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196) |
CNY 19520.00 |
|
| PH327537 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504) |
CNY 19520.00 |
|
| TP306022 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312547 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720310 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr |
CNY 1800.00 |
其它Kallikrein 11产品
