Kallikrein 11 (KLK11) (NM_144947) Human Mass Spec Standard
CAT#: PH312547
KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196)
View other "Kallikrein 11" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212547 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC212547 representing NM_144947
Red=Cloning site Green=Tags(s) MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK NN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659196 |
RefSeq Size | 1289 |
RefSeq ORF | 846 |
Synonyms | PRSS20; TLSP |
Locus ID | 11012 |
Cytogenetics | 19q13.41 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408096 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416376 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427779 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430122 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432810 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408096 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3080.00 |
|
LY416376 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 |
CNY 3080.00 |
|
LY427779 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 |
CNY 3080.00 |
|
LY430122 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3080.00 |
|
LY432810 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 |
CNY 3080.00 |
|
PH306022 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) |
CNY 14250.00 |
|
PH327537 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504) |
CNY 19520.00 |
|
TP306022 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP312547 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP327537 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr, 20 µg |
CNY 2900.00 |
|
TP720310 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr |
CNY 1800.00 |
其它Kallikrein 11产品